| Desktop | 91/100 | ✔ |
| Mobile | 87/100 | ✔ |
| Field | Data | Result |
|---|---|---|
| Page Size | 37 KB | ✔ |
| Compression | 7 KB (-80.4%) | ✔ |
| Text/Html Ratio | 1088 / 37560 (bytes) = 2.9% | ❗ |
| Load Time | 0.91 second | ✔ |
| Mobile Ready | 99/100 | ✔ |
| In-Page Links | 13 | ✔ |
| Doc Type | HTML 5 | ✔ |
| Encoding | UTF-8 | ✔ |
| Declared Language | EN-US | ✔ |
| Preferred Domain | Yes | ✔ |
| Robots.txt | Yes | ✔ |
| Url Rewrite | No | ✔ |
| Underscores in url | No | ✔ | Images Without ALT | 4 / 5 | ✘ |
| Embedded Objects (Desktop) | No | ✔ |
| Embedded Objects (Mobile) | No | ✔ |
| Iframe | No | ✔ |
| Custom 404 page | Yes | ✔ |
| Email Privacy | Yes | ✔ |
| Gsafe browsing | Yes | ✔ |
| Analytics | No | ✘ |
| W3C Validity | No | ✘ |
| Keywords | Freq | Title | Desc | <H> |
|---|---|---|---|---|
| marketing | 5 | ✔ | ✘ | ✔ |
| search | 4 | ✘ | ✘ | ✘ |
| menu | 3 | ✘ | ✘ | ✘ |
| tips | 3 | ✘ | ✘ | ✔ |
| practical | 3 | ✔ | ✘ | ✔ |
| 'social | 2 | ✘ | ✘ | ✘ |
| grow | 2 | ✘ | ✘ | ✔ |
| success' | 2 | ✘ | ✘ | ✘ |
| youactionable | 2 | ✘ | ✘ | ✘ |
| 2 | ✘ | ✘ | ✘ | |
| address | 2 | ✘ | ✘ | ✘ |
| subscribe | 2 | ✘ | ✘ | ✘ |
| delivering | 2 | ✘ | ✘ | ✘ |
| small | 2 | ✔ | ✔ | ✘ |
| local | 2 | ✔ | ✔ | ✘ |
|
With 0.91 seconds in page load, 37 KB of page size and all other reports below, the thepracticalmarketingacademy.com has a SEO score of 75 out of 100 |
| Title | The Practical Marketing Academy - For Small and Local Businesses |
| Description | For Small and Local Businesses |
| Keyword |
| Age | 0 Years, 3 Days |
| Created | 31st-Mar-2020 |
| Updated | 31st-Mar-2020 |
| Expiry | 31st-Mar-2021 |
| Host | Type | Ttl | Other |
|---|---|---|---|
| Domain Name: THEPRACTICALMARKETINGACADEMY.COM Registry Domain ID: 2509465599_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.crazydomains.com Registrar URL: http://www.crazydomains.com.au Updated Date: 2020-03-31T14:43:00Z Creation Date: 2020-03-31T14:40:26Z Registry Expiry Date: 2021-03-31T14:40:26Z Registrar: Dreamscape Networks International Pte Ltd Registrar IANA ID: 1291 Registrar Abuse Contact Email: abuse@crazydomains.com Registrar Abuse Contact Phone: +61 894 220 890 Domain Status: ok https://icann.org/epp#ok Name Server: NS1.WORDPRESS.COM Name Server: NS2.WORDPRESS.COM Name Server: NS3.WORDPRESS.COM DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of whois database: 2020-04-03T00:36:37Z |
| Server IP | 192.0.78.239 |
| Server Location | United States |
| Service Provider | Automattic |
| Domains (TLD) | Status |
|---|---|
| thepracticalmarketingacademy.net | Available |
| thepracticalmarketingacademy.org | Available |
| thepracticalmarketingacademy.biz | Already Registered |
| thepracticalmarketingacademy.io | Already Registered |
| thepracticalmarketingacademy.info | Available |
| Domains (TLD) | Status |
|---|---|
| rhepracticalmarketingacademy.com | Available |
| fhepracticalmarketingacademy.com | Available |
| ghepracticalmarketingacademy.com | Available |
| hhepracticalmarketingacademy.com | Available |
| yhepracticalmarketingacademy.com | Available |
| Dogdooremovals.com |
| Coisasdemeninasoficial.com |
| Milkytoys.com |
| Liputanmalang.com |
| Btyearbook.com |
| Pencintadewa.com |
| Fabjersey.com |
| Lithyemdevelopment.com |
| Thebasiclounge.com |
| Yeahteethwhitening.com |